version 6.0 " See ":help version" to see why this command is in the first line. " " Let people know that they are using this setup file: " echo "loading Sven's setup file for all users" " " many users also want to see the name of the file " associated with the current edit buffer in the title: let &titlestring = expand ("%:p:~:.:h") " ================================================================== " File: $HOME/.vimrc.forall (sourced by ~USER/.vimrc) " Last update: Thu Dec 21 16:16:16 MET 2000 " Purpose: Setup file for the editor Vim (Vi IMproved) " Availability: This file is available as " 27K " 76K " (mirror) " Size: This file is about 74K in size and has 1,800+ lines. " Author: Sven Guckes guckes@vim.org (guckes@math.fu-berlin.de) " " Related files: " http://www.math.fu-berlin.de/~guckes/vim/src/emacs.vim " http://www.math.fu-berlin.de/~guckes/vim/src/latex.vim " http://www.math.fu-berlin.de/~guckes/vim/src/html.vim " http://www.math.fu-berlin.de/~guckes/vim/syntax/ " =================================================================== " NOTE: If your read this then please send me an email! " I welcome all feedback on this file - especially " with new ideas such as abbreviations and mappings. " Thanks! And enjoy Vim! :-) " --Sven guckes@vim.org and guckes-vimrc@math.fu-berlin.de " =================================================================== " Webpages on Vim that you should know about: " http://www.vim.org/ Vim Home Page (actually a mirror) " http://www.vim.org/announce/ Vim Announcements " http://www.vim.org/bina.html sites with vim binaries " http://www.vim.org/bugs.html Some Vim Bugs " http://www.vim.org/deve.html Current development issues " http://www.vim.org/dist.html All mirrors in detail " http://www.vim.org/faq/ Vim FAQ " http://www.vim.org/hist.html History of ChangeLogs " http://www.vim.org/html/ Vim Helptexts in HTML " http://www.vim.org/howto/ Vim HowTo Texts " http://www.vim.org/iccf/ Vim and the ICCF (see ":help iccf") " http://www.vim.org/lang.html Language/SyntaxFile Summary " http://www.vim.org/macs.html Vim on MacOS development " http://www.vim.org/mail.html Mailing lists and all that " http://www.vim.org/mirrors.html All mirror sites (ftp and www) " http://www.vim.org/news.html NEWS about Vim and the pages " http://www.vim.org/newsgroup.html Vim on comp.editors " http://www.vim.org/orga.html vim.org background info " http://www.vim.org/pics.html Pictures: buttons,icons,screenshots " http://www.vim.org/press/ Articles on Vim in Magazines " http://www.vim.org/quotes.html Quotes on Vim by users " http://www.vim.org/sites.html Sites that use Vim officially " http://www.vim.org/syntax/ Syntax files from current version " http://www.vim.org/syntax.new/ New Syntax files (not yet in distrib) " http://www.vim.org/user.html Vim Users and their pages on Vim " http://www.vim.org/wish.html Wishlist for new features " http://www.vim.org/why.html Why to use a vi clone (Vim!) " http://www.vim.org/y2k.html Y2K issues (as if there are any..) " =================================================================== " The latest versions of Vim are usually in my signature file: " http://www.math.fu-berlin.de/~guckes/sig/SIGS Comments? " =================================================================== " Note to Windows users: Get these files from any Vim mirror: " http://www.vim.org/mirrors.html " (1) vim runtime files (docs + syntax files): " /pub/vim/pc/vim56rt.zip (1205646 bytes) " (2) gvim.exe - the precompiled binary for Windows 32bit " /pub/vim/pc/gvim56.zip (527246 bytes) " These should fit onto one floppy each. " =================================================================== " Installation of this setup file: " " To use this setup file, copy it to " this filename on these systems: " ~/.vimrc Unix and OS/2 " s:.vimrc Amiga " $VIM\_vimrc MS-DOS and Win32 " =================================================================== " Upgrade to vim-5! " NOTE: This setup file uses a lot of features of Vim-5. " If you are still using Vim-4 (or an even older version) " then you should upgrade - it is really worth the effort! " To find out why get Vim-5 and read ":help version5" or " online at http://www.vim.org/html/version5.html " =================================================================== " version check: " The first line of this setup file contains the information " "version xxx" which allows VIM to check whether the setup file " fits the syntax that it understands. " Versions of VIM other than of version 5 then will give a warning " as they do not understand this setup file command - a feature: " Give a warning so the user knows that there is something odd " about the setup file. " =================================================================== " Whitespace meta sequence: " vim-5.0s introduced the meta sequence "\s" which stands for "whitespace" " ie either a space or a tab. This makes mappings a lot easier. " I have therefore updated my mappings to use this sequence. " But this is incompatible with previous versions and, of course, Vi. " =================================================================== " Info on the latest versions is on the Vim HomePage: " http://www.vim.org/ - which is a daily mirror of the pages at " http://www.math.fu-berlin.de/~guckes/vim/ " and in Sven's signature file: " http://www.math.fu-berlin.de/~guckes/sig/SIGS " =================================================================== " =================================================================== " Structure of this file: " Lines starting with an inverted comma (") are comments. " Some mappings are commented out. Remove the comment to enable them. " " There are three kinds of things which are defined in this file: " Mapping ("map"), settings ("set"), and abbreviations ("ab"). " Settings affect the behaviour of commands. " Mappings maps a key sequence to a command. " Abbreviations define words which are replaced " right *after* they are typed in. " " =================================================================== " Note on mappings - "angle notation" (see ":help <>"): " VIM allows you to define mappings with special characters " with a notation that uses non-special characters: " The notation encloses decriptive words in angle brackets (<>). " The characters you will most often are: " for control-m " for control-v which quotes the following character " for the escape character. " All control characters have been replaced to use the angle notation " so you should be able to read this file without problems. " (Well, sometimes I leave some tabs [control-i] in the file. ;-) " =================================================================== " External programs: " Some mappings make use of external programs. " The following you should find/have on every UNIX system: " cut, date; awk, egrep, grep, ispell, perl, sed. " If you are using DOS then you should get these for you system!! " See http://www.math.fu-berlin.de/~guckes/dos/ for some pointers! " =================================================================== " 000909 " On some keyboards you will have some trouble with C-], " the command to jump to the current help tag. " The following command maps it to "\\" " which you can hopefully use as a workaround: map \\ " =================================================================== " 000307: The command ":version" does not show the current value " of VIMRUNTIME - dang! So I need a fast way to display that value: map :V :echo $VIMRUNTIME " =================================================================== " =================================================================== " HTML - HTML - HTML - HTML - HTML - HTML - HTML - HTML " =================================================================== " This has become quite big - so I moved it out to another file: " http://www.math.fu-berlin.de/~guckes/vim/source/html.vim [980227] " The "expand" is necessary to evaluate "~guckes". let FILE=expand("~guckes/.P/vim/source/html.vim") if filereadable(FILE) exe "source " . FILE endif " =================================================================== " " =================================================================== " There are many options for Vim - over 200. Here is an overview: " http://www.vim.org/options54.txt VIM-5.4 [990726] 218 options. " http://www.vim.org/options57.txt VIM-5.7 [000624] 2?? options. " http://www.vim.org/options60n.txt VIM-6.0n [000624] 2?? options. " =================================================================== " " autoindent, paste, textwidth: " I keep changing these values - just as the case may be. " Now, if functions keys actually worked on all keyboards " then I'd probably defines a toggle for each of them... " " autoindent: "off" as I usually do not write code. set noautoindent " " autowrite: Automatically save modifications to files " when you use critical (rxternal) commands. set autowrite " " backup: backups are for wimps ;-) set nobackup " " backspace: '2' allows backspacing" over " indentation, end-of-line, and start-of-line. " see also "help bs". set backspace=2 " " background: Are we using a "light" or "dark" background? " set background=dark " " compatible: Let Vim behave like Vi? Hell, no! set nocompatible " " comments default: sr:/*,mb:*,el:*/,://,b:#,:%,:XCOMM,n:>,fb:- set comments=b:#,:%,fb:-,n:>,n:) " " cpoptions you should get to know - source of many FAQs! ;-) " cpoptions: "compatible options" to match Vi behaviour " set cpoptions="aABceFs" "default! " FAQ: Do NOT include the flag '<' if you WANT angle notation! " " dictionary: english words first set dictionary=/usr/dict/words,/local/lib/german.words " Source for dictionaries (in unix-format): " ftp://ftp.fu-berlin.de/misc/dictionaries/unix-format/ " However, these are quite old. Is there a better source? " " digraph: required for those umlauts set digraph " " errorbells: damn this beep! ;-) set noerrorbells " " esckeys: allow usage of cursor keys within insert mode " You will find this useful when working, eg, on SunOS. set esckeys " " In case you want this for SunOS only: " if system('uname')=='SunOS' " set ek " endif " expandtab: Expand Tabs? Rather not. " See 'listchars' to make Tabs visible! set noexpandtab " " formatoptions: Options for the "text format" command ("gq") " I need all those options (but 'o')! set formatoptions=cqrt " " helpheight: zero disables this. set helpheight=0 " " helpfile: filename of the helpfile " set helpfile=c:\\vim-4.6\\docs\\help.txt " I usually put Vim into the directory C:\VIM-version " " helpfile: Tell Vim where to find the main helpfile (help.txt). " " Support users of old vim versions on the local net: " if version==507 " set helpfile=~guckes/share/vim-5.7/doc/help.txt " endif " " Then again - only support the latest version: " set helpfile=~guckes/share/vim/runtime/doc/help.txt " ~guckes/share: vim -> vim60k " " For use from a WindowsNT machine which mounts " the user's home directory on drive 'Z': " if has("dos16") || has("dos32") || has("gui_w32") " set helpfile=Z:\share\vim\runtime\doc\help.txt " endif " " hidden: Allow "hidden" buffers. A must-have! set hidden " " highlight=8b,db,es,hs,mb,Mn,nu,rs,sr,tb,vr,ws set highlight=8r,db,es,hs,mb,Mr,nu,rs,sr,tb,vr,ws " " hlsearch : highlight search - show the current search pattern " This is a nice feature sometimes - but it sure can get in the " way sometimes when you edit. set nohlsearch " " icon: ... set noicon " " set iconstring file of icon (icons? on a terminal? pff!) " set iconstring " " ignorecase: ignore the case in search patterns? NO! set noignorecase " " insertmode: " FAQ: Q: How can I quit insertmode when using this option? " A: The option "insertmode" was not meant for "start Vim in " insert mode" only; the idea is to *stay* in insert mode. " Anyway, you can use the command |i_CTRL-O| to issue commands. set noinsertmode " " " iskeyword: " iskeyword=@,48-57,_,192-255 (default) " Add the dash ('-'), the dot ('.'), and the '@' as "letters" to "words". " This makes it possible to expand email addresses, eg " guckes-www@vim.org set iskeyword=@,48-57,_,192-255,-,.,@-@ " " joinspaces: " insert two spaces after a period with every joining of lines. " I like this as it makes reading texts easier (for me, at least). set joinspaces " " keywordprg: Program to use for the "K" command. " set keywordprg=man\ -s " " laststatus: show status line? Yes, always! " laststatus: Even for only one buffer. set laststatus=2 " " [VIM5]lazyredraw: do not update screen while executing macros set lazyredraw " " 'list' + 'listchars': Great new feature of vim-5.3! " This tells Vim which characters to show for expanded TABs, " trailing whitespace, and end-of-lines. VERY useful!! " Standard settings: " set list " set listchars=tab:>-,trail:·,eol:$ " " However: The '$' at the end of lines is a bit too much, though. " And I quite like the character that shows a dot in the middle: " set listchars=tab:>·,trail:· " " Some people might prefer a double right angle (>>) " to show the start of expanded tabs, though: " set listchars=tab:»·,trail:· " " However, this all breaks up when viewing high-bit characters " through some brain-dead telnet program (there are many). " Sometimes a change of the font does the trick. Try it! " " magic: Use 'magic' patterns (extended regular expressions) " in search patterns? Certainly! (I just *love* "\s\+"!) set magic " " modeline: ... " Allow the last line to be a modeline - useful when " the last line in sig gives the preferred textwidth for replies. set modeline set modelines=1 " " number: ... set nonumber " " path: The list of directories to search when you specify " a file with an edit command. " Note: "~/.P" is a symlink to my dir with www pages " "$VIM/syntax" is where the syntax files are. " set path=.,,~/.P/vim,~/.P/vim/runtime/syntax,~/.P/vim/source,$VIM/syntax/ " set path=.,,~/.P/vim,~/.P/mutt/,~/.P/elm,~/.P/slrn/,~/.P/nn " " pastetoggle set pastetoggle= " " report: show a report when N lines were changed. " report=0 thus means "show all changes"! set report=0 " " ruler: show cursor position? Yep! set ruler " " runtimepath: list of dirs to search for runtime files set runtimepath=~/.vim,~/.vim/after set runtimepath+=~guckes/.vim set runtimepath+=~guckes/share/vim/runtime/ set runtimepath+=~guckes/share/vim/ set runtimepath+=~guckes/.P/Vim/syntax " had to set this now that Vim won't use "helpfiles" " to look for runtime files any more. " " Setting the "shell" is always tricky - especially when you are " trying to use the same vimrc on different operatin systems. " shell for DOS " set shell=command.com " shell for UNIX - math.fu-berlin.de BSD " set shell=zsh " shell for UNIX - inf.fu-berlin.de BSD&Solaris " set shell=zsh " shell for UNIX - zedat.fu-berlin.de BSD&Solaris " set shell=/bin/tcsh " Now that vim-5 has ":if" I am trying to automate the setting: " if has("dos16") || has("dos32") let shell='command.com' endif " gui_w32: cmd.exe " " The zsh is now available at zedat.fu-berlin.de! :-) " start the zsh as a login shell: if has("unix") let &shell="zsh\ -l" endif " " shiftwidth: Number of spaces to use for each " insertion of (auto)indent. " set shiftwidth=8 set shiftwidth=2 " " shortmess: Kind of messages to show. Abbreviate them all! " New since vim-5.0v: flag 'I' to suppress "intro message". set shortmess=at " " showcmd: Show current uncompleted command? Absolutely! set showcmd " " showmatch: Show the matching bracket for the last ')'? set showmatch " " showmode: Show the current mode? YEEEEEEEEESSSSSSSSSSS! set showmode " " suffixes: Ignore filename with any of these suffixes " when using the ":edit" command. " Most of these are files created by LaTeX. set suffixes=.aux,.bak,.dvi,.gz,.idx,.log,.ps,.swp,.tar " " startofline: no: do not jump to first character with page " commands, ie keep the cursor in the current column. set nostartofline " " splitbelow: Create new window below current one. set splitbelow " " statusline: customize contents of the windows' status line. " I prefer it this way: " Show the current buffer number and filename with info on " modification, read-only, and whether it is a help buffer " (show only when applied). " set statusline=[%n]\ %f\ %(\ %M%R%H)%) " " Move the rest to the right side, eg a copyright text: " set statusline=[%n]\ %f\ %(\ %M%R%H)%)%=(c)\ Sven\ Guckes " " Show the value of the current character in ASCII and Hex: " set statusline=[%n]\ %f\ %(\ %M%R%H)%)\=ASCII=%b\ HEX=%B " " Show the current position with line+column+virtual_column: " set statusline=[%n]\ %f\ %(\ %M%R%H)%)\=Pos=<%l\,%c%V>\ %P " Adding color through UserN groups: " set statusline=%1*[%02n]%*\ %2*%F%*\ %(\ %M%R%H)%)%=%3*Pos=<%l,%c%V>%* " User1: color for buffer number " hi User1 ctermfg=red ctermbg=white " User2: color for filename " hi User2 ctermfg=green ctermbg=white " User3: color for position " hi User3 ctermfg=blue ctermbg=white " " tabstop set tabstop=8 " " 990503: I have to set the "term" explicitly " because the standard setups are broken. " set term=builtin_pcansi " set term=xterm " " Set the colors for vim on "xterm" " if &term=="xterm" " set t_Co=8 " set t_AB=[%?%p1%{8}%<%t%p1%{40}%+%e%p1%{92}%+%;%dm " set t_AF=[%?%p1%{8}%<%t%p1%{30}%+%e%p1%{82}%+%;%dm " endif " " textmode: no - I am using Vim on UNIX! " set notextmode " " textwidth set textwidth=79 " " title: set notitle " " ttyfast: are we using a fast terminal? " seting depends on where I use Vim... set nottyfast " " ttybuiltin: set nottybuiltin " " ttyscroll: turn off scrolling -> faster! set ttyscroll=0 " " ttytype: " set ttytype=rxvt " " viminfo: What info to store from an editing session " in the viminfo file; can be used at next session. set viminfo=%,'50,\"100,:100,n~/.viminfo " " visualbell: set visualbell " " t_vb: terminal's visual bell - turned off to make Vim quiet! " Please use this as to not annoy cow-orkers in the same room. " Thankyou! :-) set t_vb= " " whichwrap: " Allow jump commands for left/right motion to wrap to previous/next " line when cursor is on first/last character in the line: set whichwrap=<,>,h,l,[,] " " wildchar the char used for "expansion" on the command line " default value is "" but I prefer the tab key: set wildchar= " " wrapmargin: set wrapmargin=1 " " writebackup: set nowritebackup " " =================================================================== " ABbreviations " =================================================================== " 980701: Moved the abbreviations *before* the mappings as " some of the abbreviations get used with some mappings. " " Abbreviations for some important numbers: iab Npi 3.1415926535897932384626433832795028841972 iab Ne 2.7182818284590452353602874713526624977573 " " Abbreviations for some classic long words: " Donau... is the German word for the (read in reverse) " "additional paragraph of the law regulating the pension of " widows to captains of the ship company on (the river) Danube" " (I am not making this up! ;-) iab YDD Donaudampfschifffahrtgesellschaftskapitaenwitwenrentengesetzzusatzparagraph " New German spelling "schifffahrt", too! (Hi, Doram!) " " 010131 iab YTNGV Telekommunikationsnummerngebuehrenverordnung " 010131 " iab YRRAG Rinderkennzeichnungs- und \ " Rindfleischetikettierungsüberwachungsaufgabenübertragungsgesetz (RkReÜAÜG) " " Some more weird sentences in KrautLang: " "Jörg möchte fünf Frühstücksbrötchen " um äußerstes Völlegefühl zu spüren." " "Äßen Löwen Möwen, zögen Möwen über Löwen rüber." " "Äße Öko-Jörg große Bärenfüße in äußerst süßer Nußölkäsesoße " müßte er in ein übermäßig häßliches Güllefaß." " Yes, KrautLang *is* weird! " " YLL : The name of a town in Wales. I am not making this up! iab YLL LLanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch " http://www.llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.co.uk " http://194.159.85.168/ - I am not making this up! :-) " " YTauma: The name of a hill in New Zealand. iab YTauma Taumatawhakatangihangakoauauotamateaturipukakapikimaungahoronukupokaiwenuakitanatahu " " Yalpha : The lower letter alphabet. iab Yalpha abcdefghijklmnopqrstuvwxyz " " YALPHA : The upper letter alphabet. iab YALPHA ABCDEFGHIJKLMNOPQRSTUVWXYZ " " Ydigit: The ten digits. iab Ydigit 1234567890 " " Yruler: A "ruler" - nice for counting the length of words. iab Yruler 1234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890 " " Yupsidedown : This describes people from "down under" (Hi, Dean!). iab Yupsidedown umop-ap!sdn " " Ysuper: A nice long word from the musical "Mary Poppins". iab Ysuper supercalifragilisticexpialidocious " " Yanti: The longest proper word in the English language?! iab Yanti antidisestablishmentarianism " " Ypass: Standard answer to Usenet posts " with the "Subject: HELP" (hehe) iab Ypass "You are in a maze of twisty little passages, all alike." " " Yicty: Some people should really RTFM! iab Yicty I could tell you - but then I'd have to kill you. " " Ybtdt: It's been dejavu all over again. iab Ybtdt Been there, done that, got the tshirt. " " Ywttc: One more person using Vim. iab Ywttc Welcome to the club! " " Ysesqui: "Sesquipedalophobia" means "fear of big words." ;-) iab Ysesqui sesquipedalophobia " " Yi18n: .123456789012345678. - yup, 18 characters betwwen 'i' and 'n' iab Yi18n internationalization " " Yanfs: Changing the Subject within a message. (Hi, Monty Python!) iab Yanfs And now for something completely different... " " " " classic pangrams (which include every letter of the alphabet): " German: " kaufen sie jede woche vier gute bequeme pelze [missing: 'xy' :-/] " sylvia wagt quick den jux bei pforzheim " bayerische jagdwitze von maxl querkopf " zwei boxkaempfer jagen eva quer durch sylt " falsches üben von xylophonmusik quält jeden größeren zwerg. " Bei jedem klugen Wort von Sokrates rief Xanthippe zynisch: Quatsch! " English: " the quick brown fox jumps over the lazy dog " French: " voyez le brick geant que j'examine pres du wharf. " Polish: " Pchn±æ w tê ³ód¼ je¿a lub o¶m skrzyñ fig. " Koñ i ¿ó³w grali w ko¶ci z piêkn± æm± u ¼ród³a. " Têgi koñ i ma³y ¿ó³w ¶piewali z piêkn± æm± u ¼ród³a ¿ycia. " " And a sentence to break some quoing levels: " "This man's house (which 's yellow) burned down." " " And now for something completely different: " I couldn't bear to bear bears over the border. " " Inserting an ellipsis to indicate deleted text iab Yell [...] vmap ,ell c[...] " " Correcting those typos. [I almost never get these right. :-(] " See also: http://www.igd.fhg.de/~zach/programs/acl/ iab alos also iab aslo also iab becuase because iab bianry binary iab bianries binaries iab charcter character iab charcters characters iab exmaple example iab exmaples examples iab shoudl should iab seperate separate iab teh the iab tpyo typo " Some frequent typos in German: iab nciht nicht iab doer oder iab Dreckfuhler Druckfehler " " Sorry, Laurent! iab Laurant Laurent " " See http://www.math.fu-berlin.de/~guckes/sig/: iab YDDS dash-dash-space " " For reports and texts on my studies: " iab YKT Komplexitaetstheorie " iab YRA Rechnerarchitektur " iab YPM Pattern Matching " see http://elib.zib.de/ICM98 : " iab YICM International Congress of Mathematicians " " Some sentences that I really use often in emails about Vim: iab YAW You are welcome! iab YEV Enjoy Vim! :-) " " Often used filenames - only needed these on the command line: " see also: http://www.math.fu-berlin.de/~guckes/setup/ " " cab ELMALIAS ~/.elm/aliases.text " cab Erc ~/.elm/elmrc " cab Mrc ~/.muttrc " cab Src ~/.slrnrc " cab Zrc ~/.zsh/.zshrc " " Email Adresses: " I usually use these when adding addresses to the header " of emails (mutt) and posts (slrn). " " Author of the Good NetKeeping Seal of Approval: ab Agnksa js@xs4all.nl (Jeroen Scheerder) " " Original author of Mutt: " ab Amutt me@cs.hmc.edu (Michael Elkins) " Maintainer of Mutt: ab Amutt roessler@guug.de (Thomas Roessler) " " Author of Slrn: ab Aslrn davis@space.mit.edu (John E. Davis) " Maintainer of Slrn: ab Mslrn tststs@gmx.de (Thomas Schultz) " " Author of Vim - vim specific address: ab Avim bram@vim.org (Bram Moolenaar) " Author of Vim - private address: ab Abram Bram@Moolenaar.net (Bram Moolenaar) " " Author, contributor, maintainer of " add atac autoconf bcpp ded dialog diffstat flist " lynx ncurses tin vile vttest xterm - and more! ab Avile dickey@his.com (Thomas E. Dickey) " " Former Maintainer of the Vim FAQ: " ab Avimfaq laurent@Grafnetix.COM (Laurent Duperval) ab Avimfaq guckes@vim.org (Sven Guckes) " " Mailing Lists (MLs) " " The Vim mailing lists: See http://www.vim.org/mail.html for more info! " ab MLvim vim@vim.org (VIM Help List) " ab MLvimdev vim-dev@vim.org (VIM General Development List) " ab MLvimmac vim-mac@vim.org (VIM on MacOS Development List) " ab MLvimmb vim-multibyte@vim.org (VIM MultiByte Development List) " ab MLvimfr vim-fr@egroups.com (VIM Help List for French Users) " " More mailing lists: " ab MLmuttdev mutt-dev@mutt.org (Mutt Developer List) " ab MLmuttuser mutt-users@mutt.org (Mutt Users List) " ab MLzsh zsh-users@sunsite.auc.dk (ZShell Users List) " " " News: newsgroup names " " Newsgroup about "warloding" of signatures - see " also http://www.math.fu-berlin.de/~guckes/afw/ iab Nafw alt.fan.warlord iab Nahbou alt.humor.best-of-usenet iab Nzedat bln.announce.fub.zedat.d iab Ncsd bln.announce.fub.cs.d iab Nce comp.editors iab NcE de.comp.editoren " Newsgroup about "lynx": iab Nhtml comp.infosystems.www.authoring.html " Newsgroup about "elm": Elm is dead - long live Mutt! iab Nelm comp.mail.elm " Newsgroup about "pine": When will they release pine-4? " iab Ncmp comp.mail.pine iab Npine comp.mail.pine " iab Ncsmd comp.sys.mac.digest " Newsgroup about "mobil phone systems": iab Ndcm de.comm.mobil iab Nmobil de.comm.mobil " Newsgroup about "web browsers": iab Nlynx comp.infosystems.www.browsers.misc iab Nnetscape comp.infosystems.www.browsers.misc " Newsgroup about "mutt" [since 980401]: The coolest mail user agent iab Nmutt comp.mail.mutt " Newsgroup about "nn": Once was the best newsreader. Still good. iab Nnn news.software.nn " Newsgroup for "newbies". " All you ever wanted to know - but were afraid to ask. ;-) iab Newbie news.newusers.questions " Newsgroup about "newsreader *agents*" (netscape and slrn): iab Nnsr news.software.readers " " Usenet header lines (used when composing a post): " iab UFT Followup-To: iab UMCT Mail-Copies-To: MYADDR iab UNG Newsgroups: iab URT Reply-To: MYADDR iab UFUB Organization: Freie Universitaet Berlin " " Current version numbers of my favourite programs: " http://www.math.fu-berlin.de/~guckes/faq/program.versions.html " And some abbreviations to type them in mail&news: " [Last update: 001221] iab Velmold ELM2.4PL25 [951204] iab Velm ELM2.5.3 [000113] iab Velmme ELMME+86 [001219] iab Vless less-358 [000709] iab Vlynx lynx-2.8.4dev14 [001103] iab Vmutt mutt-1.2.5 [000729] iab Vslrn slrn-0.9.6.3 [000918] iab Vvim vim-5.7 [000624] iab Vvimdev vim-6.0q [001217] " " My phone number (main phone number and fax): iab Yphone TEL (+49 30) 8838884FAX (+49 30) 88629362 " My cellphone number: iab Ycell TEL (+49 179) 3966141 " If you like then send me a short message to my cellphone via this page: iab FreeSMS http://www.free-sms.com/sendsms/index.php3 " My snailmail address. Postcards, anyone? iab Ysnail Sven GuckesPariser Str. 52D-10719 Berlin " My ICQ number. Chat, anyone? iab YICQ ICQ:38801898 " " My addresses (Email and WWW) " makes it easy to type them without typos ;-) ab Amaili guckes@inf.fu-berlin.de ab Amailm guckes@math.fu-berlin.de ab Amailv guckes@vim.org ab Amailz guckes@zedat.fu-berlin.de " ab Apriv sven@guckes.net ab MYADDR guckes@math.fu-berlin.de ab MYNAME Sven Guckes ab MYDOMAIN math.fu-berlin.de " ab MYDOMAIN guckes.net " " Setting the reply address when replying as the guy from SKB: " ab ASKB Sprachboerse " See also: http://www.math.fu-berlin.de/~guckes/skb/ " " My Home Pages at the departments at the FUB and elsewhere... " ab WWWb http://www.belug.org/~guckes/ ab WWWm http://www.math.fu-berlin.de/~guckes/ ab WWWi http://www.inf.fu-berlin.de/~guckes/ ab WWWz http://userpage.zedat.fu-berlin.de/~guckes/ " " WWW Pages base URLs " ab HPA http://www.math.fu-berlin.de/~guckes/afw/ ab HPa http://www.math.fu-berlin.de/~guckes/ascii/ ab HPc http://www.math.fu-berlin.de/~guckes/calvin/ ab HPD http://www.math.fu-berlin.de/~guckes/dos/ ab HPe http://www.math.fu-berlin.de/~guckes/eplus/ab.faq.html ab HPE http://www.math.fu-berlin.de/~guckes/elm/ ab HPI http://www.math.fu-berlin.de/~guckes/irc/ ab HPi http://www.math.fu-berlin.de/~guckes/ispell/ ab HPL http://www.math.fu-berlin.de/~guckes/lynx/ ab HPl http://www.math.fu-berlin.de/~guckes/less/ ab HPm http://www.math.fu-berlin.de/~guckes/mail/ ab HPme http://www.math.fu-berlin.de/~guckes/mail/edit.html ab HPM http://www.math.fu-berlin.de/~guckes/mutt/ ab HPN http://www.math.fu-berlin.de/~guckes/nn/ ab HPP http://www.math.fu-berlin.de/~guckes/pine/ ab HPp http://www.math.fu-berlin.de/~guckes/procmail/ ab HPr http://babayaga.math.fu-berlin.de/~rxvt/ ab HPR http://www.math.fu-berlin.de/~guckes/rfc/ ab HPs http://www.math.fu-berlin.de/~guckes/screen/ ab HPS http://slrn.sourceforge.net/ ab HPS1 http://www.math.fu-berlin.de/~guckes/slrn/ ab HPS2 http://www.slrn.org/ ab HPv http://www.math.fu-berlin.de/~guckes/vi/ " HPOV - the "original" URL of the Vim Home Page! ab HPOV http://www.math.fu-berlin.de/~guckes/vim/ ab HPV http://www.vim.org/ ab HPX http://www.math.fu-berlin.de/~guckes/xmas/ ab HPZ http://www.math.fu-berlin.de/~guckes/zsh/ " " Other important WWW addresses " ab URLaltavista http://www.altavista.de/textonly.html ab URLftpsearch http://ftpsearch.lycos.com/?form=advanced ab URLrpmfind http://rpmfind.net ab URLslashdot http://slashdot.org ab URLfreshmeat http://freshmeat.net " " Pictures: ab URLbambi http://www.math.fu-berlin.de/~guckes/pics/calvin/bambi.gif ab URLsecret http://www.math.fu-berlin.de/~guckes/pics/calvin/secret.gif ab URLwhome http://www.math.fu-berlin.de/~guckes/pics/calvin/who_me.gif ab URLstopspam http://www.math.fu-berlin.de/~guckes/pics/spam/stop.jpg ab URLutefuchs http://www.math.fu-berlin.de/~utefuchs/ " " The nearest vim site for me: ab FTPFUB ftp://ftp.fu-berlin.de/ ab FTPVIM ftp://ftp.fu-berlin.de/pub/misc/editors/vim/ ab URLVINE http://www.mossbayeng.com/~ron/vim/vine.html " But you should look at http://www.vim.org/dist.html instead! " " =================================================================== " Abbreviations - Header Lines for Email and News " =================================================================== " Define regexpr for headers to use with mappings " as it makes reading the mappings much easier: " cab HADDR From\\|Cc\\|To cab HEMAIL ^\(From\\|Cc\\|To\\|Date\\|Subject\\|Message-ID\\|Message-Id\\|X-\) cab HNEWS ^\(From\\|Cc\\|To\\|Date\\|Subject\\|Message-ID\\|X-\\|Newsgroups\) " " =================================================================== " Abbreviations - General Editing - Inserting Dates and Times " =================================================================== " " First, some command to add date stamps (with and without time). " I use these manually after a substantial change to a webpage. " [These abbreviations are used with the mapping for ",L".] " iab Ydate =strftime("%y%m%d") " Example: 971027 " iab Ytime =strftime("%H:%M") " Example: 14:28 " " man strftime: %T time as %H:%M:%S " iab YDT =strftime("%y%m%d %T") " Example: 971027 12:00:00 " " man strftime: %X locale's appropriate time representation iab YDT =strftime("%y%m%d %X") " Example: 000320 20:20:20 " iab YDATE =strftime("%a %b %d %T %Z %Y") " Example: Tue Dec 16 12:07:00 CET 1997 " " On Windows the functions "strftime" seems to have a different " format. Therefore the following may be necessary: [980730] " if !has("unix") " iab YDATE =strftime("%c %a") " else " iab YDATE =strftime("%D %T %a") " endif " " 000306: These two lines at the start of a Perl script " will start the first Perl in your Shell's $PATH. iab Yperlhead eval 'exec perl -w -S $0 ${1+"$@"}'if 0; " " " =================================================================== " MAPpings " =================================================================== " Caveat: Mapping must be "prefix free", ie no mapping must be the " prefix of any other mapping. Example: "map ,abc foo" and " "map ,abcd bar" will give you the error message "Ambigous mapping". " " The backslash ('\') is the only(?) unmapped key, so this is the best " key to start mappings with as this does not take away a command key. " However, the backslash is never in the same position with keyboards. " Eg on German keyboards it is AltGr-sz - don't ask. " Anyway, I have decided to start mappings with the comma as this " character is always on the same position on almost all keyboards " and I hardly have a need for that command. " " The following maps get rid of some basic problems: " " When the backspace key sends a "delete" character " then you simply map the "delete" to a "backspace" (CTRL-H): " map " " With Vim-4 the format command was just 'Q' and " I am too used to it. So I need this back! nnoremap Q gq vnoremap Q gq " " 980527 I often reformat a paragraph to fit some textwidth - " and I use the following mapping to adjust it to the " current position of the cursor: map #tw :set textwidth==col(".") " " 981210 Whenever I paste some text into VIM I have to " toggle from "nopaste" to "paste" and back again: " map :set paste!:set paste? " map [14~ :set paste!:set paste? " --> new option for this: 'pastetoggle' " " "tal" is the "trailer alignment" filter program " Hopefully it will ship with Vim one day. " vmap #t !tal " vmap #t !tal -p 0 " " Disable the command 'K' (keyword lookup) by mapping it " to an "empty command". (thanks, Lawrence! :-): " map K : " map K : " More elegant: (Hi Aziz! :-) map K " " Disable the suspend for ^Z. " I use Vim under "screen" where a suspend would lose the " connection to the " terminal - which is what I want to avoid. map :shell " " Make CTRL-^ rebound to the *column* in the previous file noremap `" " " Make "gf" rebound to last cursor position (line *and* column) noremap gf gf`" " " When I let Vim write the current buffer I frequently mistype the " command ":w" as ":W" - so I have to remap it to correct this typo: nmap :W :w " TODO: Use the following (after some testing): " command -nargs=? -bang W w " " Are you used to the Unix commands "alias" and "which"? " I sometimes use these to look up my abbreviations and mappings. " So I need them available on the command line: map :alias map map :which map " " The command {number}CTRL-G show the current nuffer number, too. " This is yet another feature that vi does not have. " As I always want to see the buffer number I map it to CTRL-G. " Pleae note that here we need to prevent a loop in the mapping by " using the comamnd "noremap"! noremap 2 " " 001010 Do the Color Test! map ,CT :sp $VIMRUNTIME/syntax/colortest.vim:so % " 000329 View the file which defines the "filetypes": map ,F :view $VIMRUNTIME/filetype.vim " " 980311 Sourcing syntax files:: map ,SO :source $VIMRUNTIME/syntax/ " " 980706,000310 View a syntax file: map ,V :view $VIMRUNTIME/syntax/ " " 000801 Hilite Test - show all current highlight groups " see ":help hitest.vim" map ,HI :so $VIMRUNTIME/syntax/hitest.vim " " 990614 Quick insertion of an empty line: " nmap o " I find this convenient - but as I am also used to proceed to " next line by pressing CR this often gives me new empty lines " when I really do not need them. :-( " " =================================================================== " Customizing the command line " =================================================================== " Valid names for keys are: " " " Many shells allow editing in "Emacs Style". " Although I love Vi, I am quite used to this kind of editing now. " So here it is - command line editing commands in emacs style: cnoremap cnoremap " cnoremap cnoremap cnoremap cnoremap cnoremap cnoremap b cnoremap cnoremap f cnoremap cnoremap " Note: More info about this is in the helptexts: :help emacs-keys " " Additional codes for that "English" keyboard at the Xterminal cnoremap [D cnoremap [C " " =================================================================== " VIM - Editing and updating the vimrc: " As I often make changes to this file I use these commands " to start editing it and also update it: if has("unix") let vimrc='~/.vimrc' else " ie: if has("dos16") || has("dos32") || has("win32") let vimrc='$VIM\_vimrc' endif nn ,u :source =vimrc nn ,v :edit =vimrc " ,v = vimrc editing (edit this file) " map ,v :e ~/.vimrc " ,u = "update" by reading this file " map ,u :source ~/.vimrc " =================================================================== " " General Editing " " Define "del" char to be the same backspace (saves a LOT of trouble!) " As the angle notation cannot be use with the LeftHandSide " with mappings you must type this in *literally*! " map 127 "cmap 127 " the same for Linux Debian which uses imap [3~ " " ;rcm = remove "control-m"s - for those mails sent from DOS: cmap ;rcm %s///g " " Make whitespace visible: " Sws = show whitespace nmap ,Sws :%s/ /_/g vmap ,Sws :%s/ /_/g " " Sometimes you just want to *see* that trailing whitespace: " Stws = show trailing whitespace nmap ,Stws :%s/ *$/_/g vmap ,Stws :%s/ *$/_/g " " General Editing - Turning umlauts into ascii (for German keyboards) " " imap ä ae " imap ö oe " imap ü ue " imap ß ss " " Ä -> Ä :%s/\Ä/Ä/gc -> D " Ö -> Ö :%s/\Ö/Ö/gc -> V " Ü -> Ü :%s/\Ü/Ü/gc -> \ " ä -> ä :%s/\ä/ä/gc -> d " ö -> ö :%s/\ö/ö/gc -> v " ü -> ü :%s/\ü/ü/gc -> | " " =================================================================== " Inserting Dates and Times / Updating Date+Time Stamps " =================================================================== " ,L = "Last update" - replace old time stamp with a new one " preserving whitespace and using internal "strftime" command: " requires the abbreviation "YDATE" map ,L 1G/Last update:\s*/e+1CYDATE map ,,L 1G/Last change:\s*/e+1CYDATE " Example: " before: "Last update: Thu Apr 6 12:07:00 CET 1967" " after: "Last update: Tue Dec 16 12:07:00 CET 1997" " " I used to read in the output from the external command "date" " but this is a little slow and does not work on all systems: " map ,L 1G/Last update: */e+1D:r!datekJ " " =================================================================== " General Editing - link to program "screen" " =================================================================== " " ,Et = edit temporary file of "screen" program map ,Et :e /tmp/screen-exchange " as a user of Unix systems you *must* have this program! " see also: http://www.math.fu-berlin.de/~guckes/screen/ " " Email/News - Editing replies/followups " " Part 1 - prepare for editing " " Part 2 - getting rid of empty (quoted) lines and space runs. " " Delete trailing whitespace: nmap :%s/\s\+$// vmap :s/\s\+$// " " ,cel = "clear empty lines" " - delete the *contents* of all lines which contain only whitespace. " note: this does not delete lines! " map ,cel :g/^[ ]*$/d map ,cel :%s/^\s\+$// " " ,del = "delete 'empty' lines" " - delete all lines which contain only whitespace " note: this does *not* delete empty lines! map ,del :g/^\s\+$/d " " ,cqel = "clear quoted empty lines" " Clears (makes empty) all lines which start with '>' " and any amount of following spaces. " nmap ,cqel :%s/^[> ]*$// " vmap ,cqel :s/^[> ]*$// " nmap ,cqel :%s/^[> ]\+$// " vmap ,cqel :s/^[> ]\+$// nmap ,cqel :%s/^[>]\+$// vmap ,cqel :s/^[> ]\+$// " NOTE: If the meta sequence "\s" " The following do not work as "\s" is not a character " and thus cannot be part of a "character set". " map ,cqel :g/^[>\s]\+$/d " " Some people have strange habits within their writing. " But if you cannot educate them - rewrite their text! ;-) " " Jason "triple-dots" King elephant@onaustralia.com.au " does uses ".." or "..." rather than the usual punctuation " (comma, semicolon, colon, full stop). So... " " Turning dot runs with following spaces into an end-of-sentence, " ie dot-space-space: vmap ,dot :s/\.\+ \+/. /g " " Gary Kline (kline@tera.tera.com) indents his " own text in replies with TAB or spaces. " Here's how to get rid of these indentation: vmap ,gary :s/^>[ ]\+\([^>]\)/> \1/ " " ,ksr = "kill space runs" " substitutes runs of two or more space to a single space: " nmap ,ksr :%s/ */ /g " vmap ,ksr :s/ */ /g nmap ,ksr :%s/ \+/ /g vmap ,ksr :s/ \+/ /g " Why can't the removal of space runs be " an option of "text formatting"? *hrmpf* " " ,Sel = "squeeze empty lines" " Convert blocks of empty lines (not even whitespace included) " into *one* empty line (within current visual): map ,Sel :g/^$/,/./-j " " ,Sbl = "squeeze blank lines" " Convert all blocks of blank lines (containing whitespace only) " into *one* empty line (within current visual): " map ,Sbl :g/^\s*$/,/[^ ]/-j " map ,Sbl :g/^\s*$/,/[^ \t]/-j map ,Sbl :g/^\s*$/,/\S/-j " " =================================================================== " Editing of email replies and Usenet followups - using autocommands " =================================================================== " " Remove ALL auto-commands. This avoids having the " autocommands twice when the vimrc file is sourced again. autocmd! " " Add/change some filename patterns to filetypes: " let myfiletypefile = "~/.vim.myfiletypes" " " And this goes into "~/.vim.myfiletypes": " augroup filetype " au BufRead,BufNewFile postpone/* set filetype=mail " augroup END " " Let Vim identify itself in the message header " when editing emails with Mutt and Slrn: " au BufNewFile,BufRead ~/.followup,.letter,tmp/mutt* let @"="X-Editor: Vim-".version." http://www.vim.org\n"|exe 'norm 1G}""P' " au FileType mail let @"="X-Editor: Vim-".version." http://www.vim.org/\n"|exe 'norm 1G}""P' " " Let Vim add a Message-ID to your posts with Slrn: " (this follows ISO8061): " " Add a Message-ID to posts with Slrn: " au BufNewFile,BufRead ~/.article let @"="Message-ID: \n"|exe 'norm 1G}""P' " Example: Message-ID: <20000406T120700@guckes.net> " Problem: The date and time are hard to read. " It's easier with a few delimiters: " " Add a Message-ID to posts with Slrn (with delimiters): " au BufNewFile,BufRead ~/.article,~/.followup let @"="Message-ID: <".strftime("%Y-%m-%dT%H-%M-%S")."@guckes.net>\n"|exe 'norm 1G}""P' " Example: Message-ID: <2000-04-06T12-07-00@guckes.net> " " news.fu-berlin.de rejects Message-IDs with colons in it: " Example: Message-ID: <2000-04-06T12:07:00@guckes.net> " " set the textwidth to 70 characters for replies (email&usenet) " au BufNewFile,BufRead .followup,.letter,tmp/mutt*,nn.*,snd.* set tw=70 " We can now abbreviate this by using the "filetype": au FileType mail set tw=70 " " Some more autocommand examples which set the values for " "autoindent", "expandtab", "shiftwidth", "tabstop", and "textwidth": " using the "FileType" event: " au FileType c set ai et sw=4 ts=4 " au FileType perl set ai et sw=4 ts=4 " au FileType html set ai sw=2 ts=2 " au FileType java set ai sw=4 ts=4 " au BufEnter */drafts/* set tw=72 " " Try to use the mapping ",D" when doing a followup. " autocmd BufNewFile ~/.followup ,D| " " Part 3 - Change Quoting Level " " ,dp = de-quote current inner paragraph " map ,dp {jma}kmb:'a,'bs/^> // map ,dp vip:s/^> // vmap ,dp :s/^> // " " ,qp = quote current paragraph " jump to first inner line, mark with 'a'; " jump to last inner line, mark with 'b'; " then do the quoting as a substitution " on the line range "'a,'b": " map ,qp {jma}kmb:'a,'bs/^/> / " vim-5 now has selection of "inner" and "all" " of current text object - mapping commented! " " ,qp = quote current paragraph (old version) " jump to first inner line, Visual, " jump to last inner line, " then do the quoting as a substitution: " map ,qp {jV}k:s/^/> / " " ,qp = quote current inner paragraph (works since vim-5.0q) " select inner paragraph " then do the quoting as a substitution: map ,qp vip:s/^/> / " " ,qp = quote current paragraph " just do the quoting as a substitution: vmap ,qp :s/^/> / " " ## = comment current inner paragraph with '#': nmap ## vip:s/^/#/ " ## = comment current text selection with '#': vmap ## :s/^/#/ " " 001006: Commenting selected lines in C style: " vmap ## :s#^#// #''>o*/gv " " Example of result: " /* " // foo " // bar " /* " " Changing quote style to *the* true quote prefix string "> ": " " Fix Supercite aka PowerQuote (Hi, Andi! :-): " before ,kpq: > Sven> text " after ,kpq: > > text " ,kpq kill power quote vmap ,kpq :s/^> *[a-zA-Z]*>/> >/ " " Fix various other quote characters: " ,fq "fix quoting" vmap ,fq :s/^> \([-":}\|][ ]\)/> > / " " Fix the quoting of "Microsoft Internet E-Mail": " The guilty mailer identifies like this: " X-Mailer: Microsoft Internet E-Mail/MAPI - 8.0.0.4211 " " And this is how it quotes - with a pseudo header: " " -----Ursprungliche Nachricht----- " Von: NAME [SMTP:ADDRESS] " Gesendet am: Donnerstag, 6. April 2000 12:07 " An: NAME " Cc: NAME " Betreff: foobar " " And here's how I "fix" this quoting: " (it makes use of the mappings ",dp" and ",qp"): map #fix /^> -----.*-----$Oj,dpdapVG,qp " " Part 4 - Weed Headers of quoted mail/post " " These mappings make use of the abbreviation that define a list of " Email headers (HEMAIL) and News headers (HNEWS): nmap ,we vip:v/HEMAIL/d vmap ,we :v/HEMAIL/d nmap ,wp vip:v/HNEWS/d vmap ,wp :v/HNEWS/d " " Old versions for vim-4.6: " ,we = "weed email header" " nmap ,we !ipegrep "^(Date:\|From \|From:\|Subject:\|To:\|$)" " vmap ,we !egrep "^(Date:\|From \|From:\|Subject:\|To:\|$)" " ,wp = "weed post header" " nmap ,wp !ipegrep "^(Date:\|From:\|Subject:\|Newsgroups:\|Followup-To:\|Keywords:\|References:\|Message-ID\|$)" " vmap ,wp !egrep "^(Date:\|From:\|Subject:\|Newsgroups:\|Followup-To:\|Keywords:\|References:\|Message-ID\|$)" " " ,ri = "Read in" basic lines from the email header " Useful when replying to an email: " nmap ,ri :r!readmsg\|egrep "^From:\|^Subject:\|^Date:\|^To: \|^Cc:" " NOTE: "readmsg" ships with the mailer ELM. " " " Part 5 - Reformatting Text " " NOTE: The following mapping require formatoptions to include 'r' " and "comments" to include "n:>" (ie "nested" comments with '>'). " " Formatting the current paragraph according to " the current 'textwidth' with ^J (control-j): " imap gqap " too dangerous for my editing ;-) nmap gqap vmap gq " " Here is a variation of this command. It inserts the character " CTRL-Z at the current position to enable to rebound to the " previous position within the text. [Hello, Y. K. Puckett!] " map igqip?x " imap gqip?xi " " ,b = break line in commented text (to be used on a space) " nmap ,b dwi> nmap ,b r " ,j = join line in commented text " (can be used anywhere on the line) " nmap ,j Jxx nmap ,j Vjgq " " ,B = break line at current position *and* join the next line " nmap ,B i>Jxx nmap ,B rVjgq " " ,,, break current line at current column, " inserting ellipsis and "filling space": " nmap ,,, ,,1,,2 " nmap ,,1 a...X...FXrlmaky$o" " nmap ,,2 :s/./ /g3X0"yy$dd`a"yP " " " =================================================================== " Edit your reply! (Or else!) " =================================================================== " " Part 6 - Inserting Special or Standard Text " Part 6a - The header " Add adresses for To: and Cc: lines " " ,ca = check alias (reads in expansion of alias name) " map ,ca :r!elmalias -f "\%v (\%n)" " ,Ca = check alias (reads in expansion of alias name) " map ,Ca :r!elmalias -f "\%n <\%v>" " " ,cc = "copy notice" " Insert a Cc line so that person will receive a "courtesy copy"; " this tells the addressee that text is a copy of a public article. " This assumes that there is exactly one empty line after the first " paragraph and the first line of the second paragraph contains the " return address with a trailing colon (which is later removed). map ,cc 1G}jyykPICc: $x " map ,cc ma1G}jy/ writes'aoCc: $p " " ,mlu = make letter urgent (by giving the "Priority: urgent") map ,mlu 1G}OPriority: urgent " " Fixing the From: line " " ,cS = change Sven's address. map ,cS 1G/^From: /e+1CSven Guckes " Used when replying as the "guy from vim". " " Adjusting my Reply-To line [001010] " " Reply-To: guckes-usenet@math.fu-berlin.de " " ,cr = change Reply-TO line map ,cr 1G/^Reply-To: guckes-usenet/e-5ct@ " " Fixing the Subject line " " Pet peeve: Unmeaningful Subject lines. Change them! " ,cs = change Subject: line map ,cs 1G/^Subject: yypIX-Old--W " This command keeps the old Subject line in "X-Old-Subject:" - " so the recipient can still search for it and " you keep a copy for editing. " " 001115: " ,CS = Change Subject: line map ,CS 1G/^Subject: :s/Re:/was:/Wi($)0Wi " This changes the "Re:" to "was:", puts everything into parentheses " and then sets the cursor before the opening bracket for insertion " of a new Subject line (which hopefully matches the contents better). " Subject: Re: something " Subject: X(was: something) " " " ,re : Condense multiple "Re:_" to just one "Re:": map ,re 1G/^Sub:s/\(Re: \)\+/Re: / " " ,Re : Change "Re: Re[n]" to "Re[n+1]" in Subject lines: map ,Re 1G/^Subject: :s/Re: Re\[\([0-9]\+\)\]/Re[\1]/ " " Put parentheses around "visual text" " Used when commenting out an old subject. " Example: " Subject: help " Subject: vim - using autoindent (Re: help) " " ,) and ,( : vmap ,( v``>a) vmap ,) v``>a) " " Part 6 - Inserting Special or Standard Text " Part 6a - Start of text - saying "hello". " " ,hi = "Hi!" (indicates first reply) map ,hi 1G}oHi! " " ,ha = "helloagain" (indicates reply to reply) map ,ha 1G}oHello, again! " " ;HA = "Hallo, !" (German equivalent of "hi!" for replies) " map ;HA G/Quoting /e+1ye1G}oHallo, !Po " map ;HA G/^\* /e+1ye1G}oHallo, !Po map ;; G/^\* /e+1ye1G}oHallo, "! " " ,He = "Hello, !" " map ,He G/Quoting /e+1ye1G}oHallo, !Po map ,He G/^\* /e+1ye1G}oHello, !Po " " Part 6 - Inserting Special or Standard Text " Part 6b - End of text - dealing with "signatures". " " remove signatures " " ,kqs = kill quoted sig (to remove those damn sigs for replies) " goto end-of-buffer, search-backwards for a quoted sigdashes " line, ie "^> -- $", and delete unto end-of-paragraph: map ,kqs G?^> -- $d} " map ,kqs G?^> *-- $dG " ,kqs = kill quoted sig unto start of own signature: " map ,kqs G?^> *-- $d/^-- $/ " " =================================== " Adding quotes and signatures easily " =================================== " " QUOTES: http://www.math.fu-berlin.de/~guckes/quotes/collection let QUOTES=expand("~/.P/quotes/collection") " " Decide which quote file to use: " if filereadable("~/.P/quotes/collection") " let QUOTES=expand("~/.P/quotes/collection") " else " use a copy in the homedir: " let QUOTES=expand("~/.quotes") " endif " " ,aq = "add quote" " Reads in a quote from my favourite quotations: " nmap ,aq :r!agrep -d "^-- $" ~/.P/quotes/collectionb nmap ,aq :exe ":r!agrep -d '^-- $' ".QUOTES " " SIGNATURES: http://www.math.fu-berlin.de/~guckes/sig/SIGS " let SIGS=expand("~/.P/sig/SIGS") if !filereadable(SIGS) " use a copy in the homedir: let SIGS=expand("~/.signatures") endif " " ,s = "sign" - " Read in signature file (requires manual completion): " nmap ,s :r!agrep -d "^-- $" ~/.P/sig/SIGS " nmap ,s :exe ":r!agrep -d '^-- $' ".SIGS nmap ,s :exe ":r!agrep -d '^-- $' '' ".SIGS " " SEE ALSO: " Sven's page on sigs: http://www.math.fu-berlin.de/~guckes/sig/ " Sven's page on agrep: http://www.math.fu-berlin.de/~guckes/agrep/ " " ,at = "add text" - " read in text file (requires manual completion): nmap ,at :r ~/.P/txt/ " " MUTT: Auto-kill signatures for replies " map ,kqs G?^> *-- $dG " autocmd BufNewFile,BufRead .followup,.letter,mutt*,nn.*,snd.* :normal ,kqs " " At the end of editing your reply you should check your spelling " with the spelling checker "ispell". " These mappings are from Lawrence Clapp lclapp@iname.com: " spellcheck the document -- skip quoted text " nmap :w ! grep -v '^>' \| spell " vmap :w ! grep -v '^>' \| spell " At home under Linux it looks something more like this: " nmap :w ! grep -v '^>' \| ispell -??? " " Tell the recipient that I was replying to an old email of his: ab SvenR Sven [finally takeing the time to reply to old emails] " " Toggles: [todo] " " toggle autoindent " toggle hlsearch " cycle textwidth between values 60, 70, 75, 80 " " =================================================================== " LaTeX - LaTeX - LaTeX - LaTeX - LaTeX - LaTeX - LaTeX " =================================================================== " This has become quite big - so I moved it out to another file: " http://www.math.fu-berlin.de/~guckes/vim/source/latex.vim let FILE="/home/robinson/emailer/guckes/.P/vim/source/latex.vim" if filereadable(FILE) let RESULT="file readable" exe "source " . FILE else let RESULT="file not readable" endif " " =================================================================== " PGP - encryption and decryption " =================================================================== " " encrypt map ;e :%!/bin/sh -c 'pgp -feast 2>/dev/tty' " decrypt map ;d :/^-----BEG/,/^-----END/!/bin/sh -c 'pgp -f 2>/dev/tty' " sign map ;s :,$! /bin/sh -c 'pgp -fast +clear 2>/dev/tty' map ;v :,/^-----END/w !pgp -m " " PGP - original mappings " " encrypt and sign (useful for mailing to someone else) "csh: map #1 :,$! /bin/sh -c 'pgp -feast 2>/dev/tty^V|^V|sleep 4' " sh: map #1 :,$! pgp -feast 2>/dev/tty^V|^V|sleep 4 " " sign (useful for mailing to someone else) "csh: map #2 :,$! /bin/sh -c 'pgp -fast +clear 2>/dev/tty' " sh: map #2 :,$! pgp -fast +clear 2>/dev/tty " " decrypt "csh: map #3 :/^-----BEG/,/^-----END/!\ " /bin/sh -c 'pgp -f 2>/dev/tty^V|^V|sleep 4' " sh: map #3 :/^-----BEG/,/^-----END/!\ " pgp -f 2>/dev/tty^V|^V|sleep 4 " " view (pages output, like more) "csh: map #4 :,/^-----END/w !pgp -m " sh: map #4 :,/^-----END/w !pgp -m " " encrypt alone (useful for encrypting for oneself) "csh: map #5 :,$! /bin/sh -c 'pgp -feat 2>/dev/tty^V|^V|sleep 4' " sh: map #5 :,$! pgp -feat 2>/dev/tty^V|^V|sleep 4 " " Elijah http://www.mathlab.sunysb.edu/~elijah/pgppub.html says : " The significant feature is that stderr is redirected independently " of stdout, and it is redirected to /dev/tty which is a synonym for " the current terminal on Unix. I don't know why the ||sleep 4 " stuff is there, but it is harmless so I left it. Since csh is such " junk, special rules are used if you are using it (tcsh, too). " ksh and bash should use the sh form. zsh, et al: consult your " manual. The # format is used to map function keys. If your " terminal does not support the requested function key, use a " literal #. Not all of the clones correctly support this. " " =================================================================== " Useful stuff. At least these are nice examples. :-) " =================================================================== " " ,t = "transpose" - aXb -> bXa " This exchanges the characters 'a' and 'b' " which are next to the current position on 'X': " map ,t XpxphXp " map ,t xphXpxp " " #b = "browse" - send selected URL to Netscape "vmap #b y:!netscape -remote "openurl "" "vmap #b y:!netscape -remote 'openFile(")' \|\| netscape " & "vmap #b y:!netscape -remote 'openFile(%:p)' || netscape file:%:p & " " " make space move the cursor to the right - much better than a *beep* " nmap \ l " " ,E = execute line " map ,E 0/\$w"yy$:yr! " This command excutes a shell command from the current line and " reads in its output into the buffer. It assumes that the command " starts with the fist word after the first '$' (the shell prompt " of /bin/sh). Try ",E" on that line, ie place the cursor on it " and then press ",E": " $ ls -la " Note: The command line commands have been remapped to tcsh style!! " " ROT13 rot13 " ,dr = decode/encode rot13 text " vmap ,dr :!tr A-Za-z N-ZA-Mn-za-m " Use this with an external "rot13" script: " " ,13 - rot13 the visual text " vmap ,13 :!rot13 " NOTE: Vim now has ROT13 built-in - see ":help g?". " see also: http://www.math.fu-berlin.de/~guckes/rot13/ " " Give the URL under the cursor to Netscape " map ,net yA:!netscape -remote "openurl "" " " " =================================================================== " Mapping of special keys - arrow keys and function keys. " =================================================================== " Buffer commands (split,move,delete) - " this makes a little more easy to deal with buffers. " (works for Linux PCs in room 030) " map :split " map :bp " map :bn " map :bd " " Buffer commands (split,move,delete) - " for Mac keyboard (Performa 5200, US keyboard) " " map [19~ :split " map [20~ :bp " map [23~ :bn " map [31~ :bd " " Obvious mappings " " map " map " " =================================================================== " FAQ: Emacs editing" " Q: How can I stay in insert mode and move around like within Emacs? " A: Get the following file and source it like it is done here: " URL: http://www.math.fu-berlin.de/~guckes/vim/source/emacs.vim let FILE="/home/robinson/emailer/guckes/.P/vim/source/emacs.vim" if filereadable(FILE) let RESULT="file readable" exe "source " . FILE else let RESULT="file not readable" endif " " Make the up and down movements move by "display/screen lines": " map j gj " map gj " map k gk " map gk " " Normal mode - tcsh style movements [960425] " " nmap 0 " nmap h " nmap x " nmap $ " nmap l " nmap b b " nmap f w " " DOS keyboard mapping for cursor keys " " map [A " map [B " map [C " map [D " imap [A " imap [B " imap [C " imap [D " " DOS keyboard " "insert" " map [1~ i " map [1~ " "home" " map [2~ ^ " map [2~ 0 " map [2~ " "pgup" " map [3~ " map [3~ " "delete" " map [4~ x " map [4~ " "end" " map [5~ $ " map [5~ " "pgdn" " map [6~ " map [6~ " " Keyboard mapping for cursor keys " [works for SUNs in Solarium (room 030) - 970815] " map OA map OB map OC map OD imap OA imap OB imap OC imap OD " " Keyboard mapping for cursor keys " [works for XTerminals - 970818] map [A map [B map [C map [D imap [A imap [B imap [C imap [D " " 000810: " Keyboard mapping for numeric keypad: " imap ON ??? imap OM map OM imap OP map OP imap OQ / map OQ / imap OR * map OR * imap OS - map OS - " imap Ol + imap Om - imap On , imap Op 0 imap Oq 1 imap Or 2 imap Os 3 imap Ot 4 imap Ou 5 imap Ov 6 imap Ow 7 imap Ox 8 imap Oy 9 imap Oz 0 " " " =================================================================== " AutoCommands " =================================================================== " " Autocommands are the key to "syntax coloring". " There's one command in your vimrc that should " load/source the file $VIM/syntax/syntax.vim " which contains the definition for colors and " the autocommands that load other syntax files " when necessary, ie when the filename matches " a given pattern, eg "*.c" or *".html". " " just load the main syntax file when Vim was compiled with "+syntax" if has("syntax") " The following sources the main syntax file, " ie. "$VIM/syntax/syntax.vim", see ":help :syn-on": syntax on " Redefine the color for "Comment": " hi! Comment term=bold ctermfg=cyan ctermbg=black guifg=blue guibg=black " hi! Comment ctermfg=blue ctermbg=black guifg=blue guibg=black hi! Comment term=NONE cterm=NONE hi! Comment ctermfg=4 ctermbg=7 guifg=blue guibg=black " " The standard background color for the GUI Vim is "blue". " No, I don't know why. But many users want to change this " color to black so they can read the blue colored text. ;-) " Here's how: " hi normal ctermbg=black guibg=black " " Adjustments for editing messages: au Syntax mail source ~guckes/.vim.mail.vim endif " " Definition of an alternative syntax file: " if has("syntax") " " Define the filename patterns for mail and news: " " MAILNEWSFILES... (missing, damn) " " Define the aucommand tow work on special files: " let aucommand = "au BufNewFile,BufRead ".MAILNEWSFILES " " execute the source command: " exe aucommand." source ~guckes/.P/vim/syntax/sven.vim" " " " endif " " " EXAMPLE: Restricting mappings to some files only: " An autocommand does the macthing on the filenames - " but abbreviations are not expanded within autocommands. " Workaround: Use "exe" for expansion: " let aucommand = "au BufNewFile,BufRead ".MAILNEWSFILES " exe aucommand." :map ,hi 1G}oHi!" " exe aucommand." :map ,ha 1G}oHello, again!" " exe aucommand." :map ,H G/Quoting /e+1ye1G}oHallo, !Po" " exe aucommand." :map ,re 1G}oRe!" " " Automatically place the cursor onto the first line of the mail body: " autocmd BufNewFile,BufRead MAILNEWSFILES :normal 1G}j " " Toggle syntax coloring on/off with "__": " nn __ mg:if has("syntax_items")syn clearelsesyn onen`g " Note: It works - but the screen flashes are quite annoying. :-/ " map :if exists("syntax_on")\| syntax off\| else\| syntax on\| endif " " =================================================================== " EXAMPLES " =================================================================== " " Visualizing trailing whitespace: " :set hls " /\s\+$ " " Toggling a numerical variable between two values. " Example: Switch the textwidth (tw) between values "70" and "80": " map \1 :let &tw = 150 - &tw " " Capitalizing the previously typed word, " returning to the previous position: " imap CAP mzB~`za " " Uppercasing the previously typed word, " returning to the previous position: " imap CAP mzvBU`za " imap CAP mzBvaWU`za " " =================================================================== " TEMPORARY STUFF - TESTING THINGS " =================================================================== " 001201: Deleting text in normal mode " using the BackSpace and Delete keys: nmap X nmap x " " 001107 " Use "bc" to evaluate the arithmetic expression on the current line " with a precision of '6' digits after the comma. " It is assumed that the current line contains only the expression. " The rsult is read in after the current line. map #BC ^y$:r!echo 'scale=6; "'\|bc " " 001010 " Add all numbers in the current visual selection. vmap ,add !awk '{total += $1 ; print} ; END {print total}' " " Example: " Remove comments from lines, select them with 'V' " then type ",add" and to execute "awk": " 123 " 456 " -789 " The result should be "210". " " " Narrow/Widen current paragraph " by adjusting the current textwidth " and using internal formatting: map [[E :set tw-=2gqip map :set tw-=2gqip vmap :set tw-=2gvgqgv vmap ( :set tw-=2gvgqgv map :set tw+=2gqip vmap :set tw+=2gvgqgv vmap ) :set tw+=2gvgqgv " " 001107: Use an explicit width for reformatting (here: 72): " map :let foo=&tw:se tw=72gqip:set tw=&foo " " screenshot from webpage shown with "links" " contains escape codes which need deleting. vmap p :s#([0B]##g " " Apply my syntax file on files with extension "sdg": au BufNewFile,BufRead *.sdg set ft=sveng " " Apply the muttrc coloring to my mutt setup files: au BufNewFile,BufRead .mutt.* set ft=muttrc " " View a html document (or part of it) with lynx. You need " a system that supports the /def/fd/* file descriptors :-( " nmap ,ly :w !lynx -force_html /dev/fd/0 " vmap ,ly :w !lynx -force_html /dev/fd/0 " " Make Vim jump back one word in normal mode with , " when it produces the code "OD": " nmap OD b " " Some simple example of the "expand modifiers": " insert the current filename *with* path: iab YPATHFILE =expand("%:p") " insert the current filename *without* path: iab YFILE =expand("%:t:r") " insert the path of current file: iab YPATH =expand("%:h") iab YDIR =expand("%:p:h") " For more help see ":help filename-modifiers". " " Toggle highlight search and report the current value: " map #1 :set hls! " map #2 :echo "HLSearch: " . strpart("OffOn",3*&hlsearch,3) " map ## #1#2 " " Sorting current line containing a list of numbers " map ## :s/ //gvip!sort -n " " Replying to the mutt mailing list: " Remove header lines Cc: and Bcc: and insert [mutt] at the beginning " map ,MM 1G/^Cc:2dd}o[mutt] " " map ,U %s###gc " map ,F {jma}kmb:'a,'b!sed -e "s/^>//"|\ " sed -f ~/.P/elm/scripts/weedout.sed " map ,mb ebiEadw " " stripping netscape bookmarks and making them list items " vmap ,ns :.,$s/^ *
<\(A.*"\) ADD.*">\(.*\)$/
  • <\1>\2/ " " Jump to the last space before the 80th column. " map ,\| 80\|F " " extracting variable names from mutt's init.c " :%s/^.*"\([a-z0-9_]*\)".*$/\1/ " " \<> = change to <> notation by substituting ^M and ^[ " cab \<> s///gc:s///gc " " Changing the From_ line in pseudo mail folders to an appropriate " value - so you can read them with a mailer. " %s/^From /From guckes Thu Apr 6 12:07:00 1967/ " " =================================================================== " ASCII tables - you may need them some day. Save them to a file! " =================================================================== " " 001005: In need of an ASII table? Perl is your friend: " perl -e 'while($i++<256) { print chr($i); }' " " ASCII Table - | octal value - name/char | " " |000 nul|001 soh|002 stx|003 etx|004 eot|005 enq|006 ack|007 bel| " |010 bs |011 ht |012 nl |013 vt |014 np |015 cr |016 so |017 si | " |020 dle|021 dc1|022 dc2|023 dc3|024 dc4|025 nak|026 syn|027 etb| " |030 can|031 em |032 sub|033 esc|034 fs |035 gs |036 rs |037 us | " |040 sp |041 ! |042 " |043 # |044 $ |045 % |046 & |047 ' | " |050 ( |051 ) |052 * |053 + |054 , |055 - |056 . |057 / | " |060 0 |061 1 |062 2 |063 3 |064 4 |065 5 |066 6 |067 7 | " |070 8 |071 9 |072 : |073 ; |074 < |075 = |076 > |077 ? | " |100 @ |101 A |102 B |103 C |104 D |105 E |106 F |107 G | " |110 H |111 I |112 J |113 K |114 L |115 M |116 N |117 O | " |120 P |121 Q |122 R |123 S |124 T |125 U |126 V |127 W | " |130 X |131 Y |132 Z |133 [ |134 \ |135 ] |136 ^ |137 _ | " |140 ` |141 a |142 b |143 c |144 d |145 e |146 f |147 g | " |150 h |151 i |152 j |153 k |154 l |155 m |156 n |157 o | " |160 p |161 q |162 r |163 s |164 t |165 u |166 v |167 w | " |170 x |171 y |172 z |173 { |174 | |175 } |176 ~ |177 del| " " =================================================================== " ASCII Table - | decimal value - name/char | " " |000 nul|001 soh|002 stx|003 etx|004 eot|005 enq|006 ack|007 bel| " |008 bs |009 ht |010 nl |011 vt |012 np |013 cr |014 so |015 si | " |016 dle|017 dc1|018 dc2|019 dc3|020 dc4|021 nak|022 syn|023 etb| " |024 can|025 em |026 sub|027 esc|028 fs |029 gs |030 rs |031 us | " |032 sp |033 ! |034 " |035 # |036 $ |037 % |038 & |039 ' | " |040 ( |041 ) |042 * |043 + |044 , |045 - |046 . |047 / | " |048 0 |049 1 |050 2 |051 3 |052 4 |053 5 |054 6 |055 7 | " |056 8 |057 9 |058 : |059 ; |060 < |061 = |062 > |063 ? | " |064 @ |065 A |066 B |067 C |068 D |069 E |070 F |071 G | " |072 H |073 I |074 J |075 K |076 L |077 M |078 N |079 O | " |080 P |081 Q |082 R |083 S |084 T |085 U |086 V |087 W | " |088 X |089 Y |090 Z |091 [ |092 \ |093 ] |094 ^ |095 _ | " |096 ` |097 a |098 b |099 c |100 d |101 e |102 f |103 g | " |104 h |105 i |106 j |107 k |108 l |109 m |110 n |111 o | " |112 p |113 q |114 r |115 s |116 t |117 u |118 v |119 w | " |120 x |121 y |122 z |123 { |124 | |125 } |126 ~ |127 del| " " =================================================================== " ASCII Table - | hex value - name/char | " " | 00 nul| 01 soh| 02 stx| 03 etx| 04 eot| 05 enq| 06 ack| 07 bel| " | 08 bs | 09 ht | 0a nl | 0b vt | 0c np | 0d cr | 0e so | 0f si | " | 10 dle| 11 dc1| 12 dc2| 13 dc3| 14 dc4| 15 nak| 16 syn| 17 etb| " | 18 can| 19 em | 1a sub| 1b esc| 1c fs | 1d gs | 1e rs | 1f us | " | 20 sp | 21 ! | 22 " | 23 # | 24 $ | 25 % | 26 & | 27 ' | " | 28 ( | 29 ) | 2a * | 2b + | 2c , | 2d - | 2e . | 2f / | " | 30 0 | 31 1 | 32 2 | 33 3 | 34 4 | 35 5 | 36 6 | 37 7 | " | 38 8 | 39 9 | 3a : | 3b ; | 3c < | 3d = | 3e > | 3f ? | " | 40 @ | 41 A | 42 B | 43 C | 44 D | 45 E | 46 F | 47 G | " | 48 H | 49 I | 4a J | 4b K | 4c L | 4d M | 4e N | 4f O | " | 50 P | 51 Q | 52 R | 53 S | 54 T | 55 U | 56 V | 57 W | " | 58 X | 59 Y | 5a Z | 5b [ | 5c \ | 5d ] | 5e ^ | 5f _ | " | 60 ` | 61 a | 62 b | 63 c | 64 d | 65 e | 66 f | 67 g | " | 68 h | 69 i | 6a j | 6b k | 6c l | 6d m | 6e n | 6f o | " | 70 p | 71 q | 72 r | 73 s | 74 t | 75 u | 76 v | 77 w | " | 78 x | 79 y | 7a z | 7b { | 7c | | 7d } | 7e ~ | 7f del| " =================================================================== " Yet another example for an autocommand: [980616] au VimLeave * echo "Thanks for using Vim"version". --Sven Guckes@vim.org!" " =================================================================== " Last but not least... " ===================================================== " The last line is allowed to be a "modeline" with my setup. " It gives vim commands for setting variable values that are " specific for editing this file. Used mostly for setting " the textwidth (tw) and the "shiftwidth" (sw). " Note that the colon within the value of "comments" needs to " be escaped with a backslash! (Thanks, Thomas!) " vim:tw=70 et sw=4 comments=\:\"